Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

TBC1D25 antibody (TBC1 Domain Family, Member 25) (N-Term) Primary Antibody

TBC1D25 Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal
Catalog No. ABIN632894
$517.86
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Binding Specificity
    N-Term
    Reactivity
    Human, Mouse, Rat
    Host
    Rabbit
    Clonality
    Polyclonal
    Application
    Western Blotting (WB)
    Specificity
    TBC1 D25 antibody was raised against the N terminal of TBC1 25
    Purification
    Affinity purified
    Immunogen
    TBC1 D25 antibody was raised using the N terminal of TBC1 25 corresponding to a region with amino acids KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    TBC1D25 Blocking Peptide, catalog no. 33R-4721, is also available for use as a blocking control in assays to test for specificity of this TBC1D25 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 25 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Alternative Name
    TBC1D25 (TBC1D25 Antibody Abstract)
    Background
    This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.
    Molecular Weight
    76 kDa (MW of target protein)
You are here: