RAGE antibody (N-Term)

Catalog No. ABIN632910

The Rabbit Polyclonal anti-RAGE antibody (ABIN632910) specifically detects RAGE in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for RAGE antibody (N-Term) (ABIN632910)

Target: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAGE antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAGE Antibody

Binding Specificity: N-Term

Specificity: RAGE antibody was raised against the N terminal of RAGE

Purification: Affinity purified

Immunogen: RAGE antibody was raised using the N terminal of RAGE corresponding to a region with amino acids MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAGE Blocking Peptide, (ABIN5615742), is also available for use as a blocking control in assays to test for specificity of this RAGE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAGE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAGE

Target: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Alternative Name: RAGE

Background: RAGE is able to phosphorylate several exogenous substrates and to undergo autophosphorylation.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, S100 Proteins