SNAP47 antibody (Middle Region)

Catalog No. ABIN632958

Product Details anti-SNAP47 Antibody

Target: SNAP47 (Synaptosomal-Associated Protein, 47kDa (SNAP47))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNAP47 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF142 antibody was raised against the middle region of C1 rf142

Purification: Affinity purified

Immunogen: C1 ORF142 antibody was raised using the middle region of C1 rf142 corresponding to a region with amino acids TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF142 Blocking Peptide, catalog no. 33R-8979, is also available for use as a blocking control in assays to test for specificity of this C1ORF142 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF142 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNAP47

Target: SNAP47 (Synaptosomal-Associated Protein, 47kDa (SNAP47))

Alternative Name: C1ORF142 (SNAP47 Products)

Synonyms: 1110031B06Rik antibody, SNAP-47 antibody, RGD735194 antibody, zgc:153222 antibody, C1orf142 antibody, HEL170 antibody, SVAP1 antibody, C7H1orf142 antibody, synaptosome associated protein 47 antibody, synaptosome associated protein 47kDa L homeolog antibody, synaptosome associated protein 47kDa antibody, synaptosomal-associated protein, 47 antibody, SNAP47 antibody, snap47.L antibody, snap47 antibody, Snap47 antibody

Background: The C1ORF142 protein may play a role in intracellular membrane fusion.

Molecular Weight: 51 kDa (MW of target protein)