SNAP47 antibody (Middle Region)

Catalog No. ABIN632958

The Rabbit Polyclonal anti-SNAP47 antibody (ABIN632958) specifically detects SNAP47 in WB. The antibody is reactive with Human samples.

Quick Overview for SNAP47 antibody (Middle Region) (ABIN632958)

Target: SNAP47 (Synaptosomal-Associated Protein, 47kDa (SNAP47))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNAP47 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SNAP47 Antibody

Binding Specificity: Middle Region

Specificity: C1 ORF142 antibody was raised against the middle region of C1 rf142

Purification: Affinity purified

Immunogen: C1 ORF142 antibody was raised using the middle region of C1 rf142 corresponding to a region with amino acids TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF142 Blocking Peptide, (ABIN5612454), is also available for use as a blocking control in assays to test for specificity of this C1ORF142 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF142 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNAP47

Target: SNAP47 (Synaptosomal-Associated Protein, 47kDa (SNAP47))

Alternative Name: C1ORF142

Background: The C1ORF142 protein may play a role in intracellular membrane fusion.

Molecular Weight: 51 kDa (MW of target protein)