UGGT1 antibody (Middle Region)

Catalog No. ABIN633063

Product Details anti-UGGT1 Antibody

Target: UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGGT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGCGL1 antibody was raised against the middle region of µgCGL1

Purification: Affinity purified

Immunogen: UGCGL1 antibody was raised using the middle region of µgCGL1 corresponding to a region with amino acids AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGCGL1 Blocking Peptide, catalog no. 33R-1061, is also available for use as a blocking control in assays to test for specificity of this µgCGL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGGT1

Target: UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))

Alternative Name: UGCGL1 (UGGT1 Products)

Synonyms: UGCGL1 antibody, ugcgl1 antibody, uggt2 antibody, 0910001L17Rik antibody, A930007H10Rik antibody, AA589501 antibody, AI414429 antibody, AI448372 antibody, C820010P03Rik antibody, GT antibody, UGT1 antibody, Ugcgl1 antibody, Uggt antibody, rUGT1 antibody, HUGT1 antibody, EMS-mutagenized bri1 suppressor 1 antibody, F3I17.13 antibody, F3I17_13 antibody, PRIORITY IN SWEET LIFE 2 antibody, PSL2 antibody, UDP-GLUCOSE:GLYCOPROTEIN GLUCOSYLTRANSFERASE antibody, UGGT antibody, UDP-glucose glycoprotein glucosyltransferase 1 antibody, UDP-glucose glycoprotein glucosyltransferase 1 L homeolog antibody, UDP-glucose:glycoprotein glucosyltransferase 1 antibody, EMS-MUTAGENIZED BRI1 SUPPRESSOR 1 antibody, UGGT1 antibody, uggt1.L antibody, uggt1 antibody, LOC100545947 antibody, Uggt1 antibody, EBS1 antibody

Background: UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.

Molecular Weight: 175 kDa (MW of target protein)

Pathways: Activation of Innate immune Response