RAB11FIP2 antibody

Catalog No. ABIN633082

Product Details anti-RAB11FIP2 Antibody

Target: RAB11FIP2 (RAB11 Family Interacting Protein 2 (Class I) (RAB11FIP2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB11FIP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RAB11 FIP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB11FIP2 Blocking Peptide, catalog no. 33R-5150, is also available for use as a blocking control in assays to test for specificity of this RAB11FIP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB10 IP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB11FIP2

Target: RAB11FIP2 (RAB11 Family Interacting Protein 2 (Class I) (RAB11FIP2))

Alternative Name: RAB11FIP2 (RAB11FIP2 Products)

Synonyms: RGD1308538 antibody, Rab11-FIP2 antibody, nRip11 antibody, 4930470G04Rik antibody, A830046J09Rik antibody, AW558126 antibody, Nrip11 antibody, RAB11 family interacting protein 2 antibody, RAB11 family interacting protein 2 (class I) antibody, Rab11fip2 antibody, RAB11FIP2 antibody

Background: RAB11FIP2 is a Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane.RAB11FIP2 is also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA).

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Hormone Transport, Carbohydrate Homeostasis