POLI antibody

Catalog No. ABIN633154

This Rabbit Polyclonal antibody specifically detects POLI in WB. It exhibits reactivity toward Human.

Quick Overview for POLI antibody (ABIN633154)

Target: POLI (Polymerase (DNA Directed) iota (POLI))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLI antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-POLI Antibody

Purification: Affinity purified

Immunogen: POLI antibody was raised using a synthetic peptide corresponding to a region with amino acids PVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLI Blocking Peptide, (ABIN5615457), is also available for use as a blocking control in assays to test for specificity of this POLI antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLI

Target: POLI (Polymerase (DNA Directed) iota (POLI))

Alternative Name: POLI

Background: POLI is an error-prone DNA polymerase specifically involved in DNA repair.POLI plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. POLI favors Hoogsteen base-pairing in the active site.POLI inserts the correct base with high-fidelity opposite an adenosine template.

Molecular Weight: 83 kDa (MW of target protein)

Pathways: DNA Damage Repair