MMP19 antibody (N-Term)

Catalog No. ABIN633173

The Rabbit Polyclonal anti-MMP19 antibody has been validated for WB and IHC. It is suitable to detect MMP19 in samples from Human and Dog.

Quick Overview for MMP19 antibody (N-Term) (ABIN633173)

Target: MMP19 (Matrix Metallopeptidase 19 (MMP19))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP19 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-MMP19 Antibody

Binding Specificity: N-Term

Specificity: MMP19 antibody was raised against the N terminal of MMP19

Purification: Affinity purified

Immunogen: MMP19 antibody was raised using the N terminal of MMP19 corresponding to a region with amino acids ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MMP19 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this MMP19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMP19

Target: MMP19 (Matrix Metallopeptidase 19 (MMP19))

Alternative Name: MMP19

Background: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of MMP-19 has not been determined. This gene corresponding to this protein was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19). Multiple transcript variants encoding distict isoforms have been identified for this gene.

Molecular Weight: 56 kDa (MW of target protein)