TMPRSS6 antibody (N-Term)

Catalog No. ABIN633178

This Rabbit Polyclonal antibody specifically detects TMPRSS6 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TMPRSS6 antibody (N-Term) (ABIN633178)

Target: TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMPRSS6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMPRSS6 Antibody

Binding Specificity: N-Term

Specificity: TMPRSS6 antibody was raised against the N terminal of TMPRSS6

Purification: Affinity purified

Immunogen: TMPRSS6 antibody was raised using the N terminal of TMPRSS6 corresponding to a region with amino acids LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMPRSS6 Blocking Peptide, (ABIN5616699), is also available for use as a blocking control in assays to test for specificity of this TMPRSS6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMPRSS6

Target: TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))

Alternative Name: TMPRSS6

Background: TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.

Molecular Weight: 90 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis