PABP antibody

Catalog No. ABIN633226

This Rabbit Polyclonal antibody specifically detects PABP in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PABP antibody (ABIN633226)

Target: PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PABP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PABP Antibody

Purification: Affinity purified

Immunogen: PABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PABPC1 Blocking Peptide, (ABIN5615183), is also available for use as a blocking control in assays to test for specificity of this PABPC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PABP

Target: PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))

Alternative Name: PABPC1

Background: The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation.

Molecular Weight: 71 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome