HNRNPA2B1 antibody (N-Term)

Catalog No. ABIN633233

Product Details anti-HNRNPA2B1 Antibody

Target: HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPA2B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HNRNPA2 B1 antibody was raised against the N terminal of HNRNPA2 1

Purification: Affinity purified

Immunogen: HNRNPA2 B1 antibody was raised using the N terminal of HNRNPA2 1 corresponding to a region with amino acids MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRNPA2B1 Blocking Peptide, catalog no. 33R-5932, is also available for use as a blocking control in assays to test for specificity of this HNRNPA2B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRNPA0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPA2B1

Target: HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))

Alternative Name: HNRNPA2B1 (HNRNPA2B1 Products)

Synonyms: HNRNPA2 antibody, HNRNPB1 antibody, HNRPA2 antibody, HNRPA2B1 antibody, HNRPB1 antibody, RNPA2 antibody, SNRPB1 antibody, hnrpa2b1 antibody, MGC53135 antibody, HNRNPA2B1 antibody, hnrnpa2 antibody, hnrnpb1 antibody, hnrpa2 antibody, hnrpb1 antibody, rnpa2 antibody, snrpb1 antibody, 9130414A06Rik antibody, Hnrpa2 antibody, Hnrpa2b1 antibody, hnrnp-A antibody, hnRNP antibody, heterogeneous nuclear ribonucleoprotein A2/B1 antibody, heterogeneous nuclear ribonucleoprotein A2/B1 S homeolog antibody, heterogeneous nuclear ribonucleoproteins A2/B1 antibody, HNRNPA2B1 antibody, hnrnpa2b1.S antibody, hnrnpa2b1 antibody, Hnrnpa2b1 antibody, LOC100353281 antibody

Background: HNRNPA2B1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molecular Weight: 37 kDa (MW of target protein)