EXOSC2 antibody (Middle Region)

Catalog No. ABIN633278

The Rabbit Polyclonal anti-EXOSC2 antibody has been validated for WB. It is suitable to detect EXOSC2 in samples from Human and Mouse.

Quick Overview for EXOSC2 antibody (Middle Region) (ABIN633278)

Target: EXOSC2 (Exosome Component 2 (EXOSC2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOSC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EXOSC2 Antibody

Binding Specificity: Middle Region

Specificity: EXOSC2 antibody was raised against the middle region of EXOSC2

Purification: Affinity purified

Immunogen: EXOSC2 antibody was raised using the middle region of EXOSC2 corresponding to a region with amino acids AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOSC2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this EXOSC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOSC2

Target: EXOSC2 (Exosome Component 2 (EXOSC2))

Alternative Name: EXOSC2

Background: EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome