JAKMIP1 antibody (Middle Region)

Catalog No. ABIN633295

Product Details anti-JAKMIP1 Antibody

Target: JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This JAKMIP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: JAKMIP1 antibody was raised against the middle region of JAKMIP1

Purification: Affinity purified

Immunogen: JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

JAKMIP1 Blocking Peptide, catalog no. 33R-2981, is also available for use as a blocking control in assays to test for specificity of this JAKMIP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAKMIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for JAKMIP1

Target: JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))

Alternative Name: JAKMIP1 (JAKMIP1 Products)

Synonyms: MGC81051 antibody, Gababrbp antibody, JAMIP1 antibody, MARLIN1 antibody, 5830437M04Rik antibody, C330021K24Rik antibody, Marlin-1 antibody, janus kinase and microtubule interacting protein 1 antibody, janus kinase and microtubule interacting protein 1 L homeolog antibody, janus kinase and microtubule-interacting protein 1 antibody, Celf_2690 antibody, JAKMIP1 antibody, jakmip1.L antibody, LOC100070079 antibody, jakmip1 antibody, LOC100432594 antibody, Jakmip1 antibody

Background: JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome