DHX58 antibody

Catalog No. ABIN633307

Product Details anti-DHX58 Antibody

Target: DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX58 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHX58 Blocking Peptide, catalog no. 33R-1634, is also available for use as a blocking control in assays to test for specificity of this DHX58 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX58 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHX58

Target: DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))

Alternative Name: DHX58 (DHX58 Products)

Synonyms: MGC82787 antibody, DHX58 antibody, lgp2 antibody, D11LGP2 antibody, D11lgp2e antibody, LGP2 antibody, RLR-3 antibody, B430001I08Rik antibody, D11Lgp2e antibody, LPG2 antibody, Lgp2 antibody, RGD1310093 antibody, DEXH-box helicase 58 L homeolog antibody, DExH-box helicase 58 antibody, probable ATP-dependent RNA helicase DHX58 antibody, DEXH (Asp-Glu-X-His) box polypeptide 58 antibody, DEXH-box helicase 58 antibody, dhx58.L antibody, DHX58 antibody, dhx58 antibody, LOC100566102 antibody, Dhx58 antibody

Background: DHX58 is the negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interacts with DDX58 and negatively regulates DDX58-mediated signaling.

Molecular Weight: 76 kDa (MW of target protein)