THO Complex 3 antibody (Middle Region)

Catalog No. ABIN633329

The Rabbit Polyclonal anti-THO Complex 3 antibody has been validated for WB. It is suitable to detect THO Complex 3 in samples from Human, Mouse and Rat.

Quick Overview for THO Complex 3 antibody (Middle Region) (ABIN633329)

Target: THO Complex 3 (THOC3)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This THO Complex 3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-THO Complex 3 Antibody

Binding Specificity: Middle Region

Specificity: THOC3 antibody was raised against the middle region of THOC3

Purification: Affinity purified

Immunogen: THOC3 antibody was raised using the middle region of THOC3 corresponding to a region with amino acids LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

THOC3 Blocking Peptide, (ABIN5616589), is also available for use as a blocking control in assays to test for specificity of this THOC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for THO Complex 3

Target: THO Complex 3 (THOC3)

Alternative Name: THOC3

Background: THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.

Molecular Weight: 39 kDa (MW of target protein)