MECOM antibody (Middle Region)
-
- Target See all MECOM Antibodies
- MECOM (MDS1 and EVI1 Complex Locus (MECOM))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MECOM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EVI1 antibody was raised against the middle region of EVI1
- Purification
- Affinity purified
- Immunogen
- EVI1 antibody was raised using the middle region of EVI1 corresponding to a region with amino acids KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT
- Top Product
- Discover our top product MECOM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EVI1 Blocking Peptide, catalog no. 33R-4417, is also available for use as a blocking control in assays to test for specificity of this EVI1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVI1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MECOM (MDS1 and EVI1 Complex Locus (MECOM))
- Alternative Name
- EVI1 (MECOM Products)
- Synonyms
- AML1-EVI-1 antibody, EVI1 antibody, MDS1 antibody, MDS1-EVI1 antibody, PRDM3 antibody, D630039M04Rik antibody, Evi-1 antibody, Evi1 antibody, Jbo antibody, Mds antibody, Mds1 antibody, Mds1-Evi1 antibody, Prdm3 antibody, Znfpr1b1 antibody, evi1 antibody, im:7140716 antibody, prdm3 antibody, evi-1 antibody, mecom antibody, mecom-a antibody, mecom-b antibody, xEvi-1 antibody, evi1-B antibody, MDS1 and EVI1 complex locus antibody, MDS1 and EVI1 complex locus L homeolog antibody, MDS1 and EVI1 complex locus S homeolog antibody, MECOM antibody, Mecom antibody, mecom antibody, mecom.L antibody, mecom.S antibody
- Background
- EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.
- Molecular Weight
- 118 kDa (MW of target protein)
-