HDLBP antibody

Catalog No. ABIN633335

The Rabbit Polyclonal anti-HDLBP antibody is suitable to detect HDLBP in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for HDLBP antibody (ABIN633335)

Target: HDLBP (High Density Lipoprotein Binding Protein (HDLBP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HDLBP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HDLBP Antibody

Purification: Affinity purified

Immunogen: HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HDLBP Blocking Peptide, (ABIN5613978), is also available for use as a blocking control in assays to test for specificity of this HDLBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDLBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HDLBP

Target: HDLBP (High Density Lipoprotein Binding Protein (HDLBP))

Alternative Name: HDLBP

Background: HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.

Molecular Weight: 141 kDa (MW of target protein)