MECOM antibody (N-Term)

Catalog No. ABIN633344

Product Details anti-MECOM Antibody

Target: MECOM (MDS1 and EVI1 Complex Locus (MECOM))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MECOM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EVI1 antibody was raised against the N terminal of EVI1

Purification: Affinity purified

Immunogen: EVI1 antibody was raised using the N terminal of EVI1 corresponding to a region with amino acids VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EVI1 Blocking Peptide, catalog no. 33R-9619, is also available for use as a blocking control in assays to test for specificity of this EVI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MECOM

Target: MECOM (MDS1 and EVI1 Complex Locus (MECOM))

Alternative Name: EVI1 (MECOM Products)

Synonyms: AML1-EVI-1 antibody, EVI1 antibody, MDS1 antibody, MDS1-EVI1 antibody, PRDM3 antibody, D630039M04Rik antibody, Evi-1 antibody, Evi1 antibody, Jbo antibody, Mds antibody, Mds1 antibody, Mds1-Evi1 antibody, Prdm3 antibody, Znfpr1b1 antibody, evi1 antibody, im:7140716 antibody, prdm3 antibody, evi-1 antibody, mecom antibody, mecom-a antibody, mecom-b antibody, xEvi-1 antibody, evi1-B antibody, MDS1 and EVI1 complex locus antibody, MDS1 and EVI1 complex locus L homeolog antibody, MDS1 and EVI1 complex locus S homeolog antibody, MECOM antibody, Mecom antibody, mecom antibody, mecom.L antibody, mecom.S antibody

Background: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.

Molecular Weight: 118 kDa (MW of target protein)