LARP1 antibody (N-Term)

Catalog No. ABIN633490

This Rabbit Polyclonal antibody specifically detects LARP1 in WB. It exhibits reactivity toward Human.

Quick Overview for LARP1 antibody (N-Term) (ABIN633490)

Target: LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LARP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LARP1 Antibody

Binding Specificity: N-Term

Specificity: LARP1 antibody was raised against the N terminal of LARP1

Purification: Affinity purified

Immunogen: LARP1 antibody was raised using the N terminal of LARP1 corresponding to a region with amino acids HKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LARP1 Blocking Peptide, (ABIN939157), is also available for use as a blocking control in assays to test for specificity of this LARP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LARP1

Target: LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))

Alternative Name: LARP1

Background: LARP1 belongs to the LARP family and it contains 1 HTH La-type RNA-binding domain. The exact function of LARP1 remains unknown.

Molecular Weight: 116 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection