PTBP2 antibody (N-Term)
-
- Target See all PTBP2 Antibodies
- PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTBP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PTBP2 antibody was raised against the N terminal of PTBP2
- Purification
- Affinity purified
- Immunogen
- PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids AITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAV
- Top Product
- Discover our top product PTBP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTBP2 Blocking Peptide, catalog no. 33R-1284, is also available for use as a blocking control in assays to test for specificity of this PTBP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))
- Alternative Name
- PTBP2 (PTBP2 Products)
- Synonyms
- PTB antibody, PTBLP antibody, brPTB antibody, nPTB antibody, nPTB5 antibody, nPTB6 antibody, nPTB7 antibody, nPTB8 antibody, Ptb2 antibody, PTBP2 antibody, im:7153495 antibody, ptbp2 antibody, si:ch211-160l17.2 antibody, wu:fa08f05 antibody, wu:fc05d10 antibody, zgc:113074 antibody, polypyrimidine tract binding protein 2 antibody, polypyrimidine tract binding protein 2b antibody, polypyrimidine tract binding protein 2a antibody, PTBP2 antibody, Ptbp2 antibody, ptbp2b antibody, ptbp2a antibody
- Background
- The protein encoded by this gene binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, SARS-CoV-2 Protein Interactome
-