EWSR1 antibody (N-Term)

Catalog No. ABIN633586

This Rabbit Polyclonal antibody specifically detects EWSR1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for EWSR1 antibody (N-Term) (ABIN633586)

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EWSR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EWSR1 Antibody

Binding Specificity: N-Term

Specificity: EWSR1 antibody was raised against the N terminal of EWSR1

Purification: Affinity purified

Immunogen: EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EWSR1 Blocking Peptide, (ABIN5613422), is also available for use as a blocking control in assays to test for specificity of this EWSR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EWSR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EWSR1

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Alternative Name: EWSR1

Background: EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.

Molecular Weight: 52 kDa (MW of target protein)