EWSR1 antibody (N-Term)
-
- Target See all EWSR1 Antibodies
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EWSR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EWSR1 antibody was raised against the N terminal of EWSR1
- Purification
- Affinity purified
- Immunogen
- EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
- Top Product
- Discover our top product EWSR1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EWSR1 Blocking Peptide, catalog no. 33R-7315, is also available for use as a blocking control in assays to test for specificity of this EWSR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EWSR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
- Alternative Name
- EWSR1 (EWSR1 Products)
- Synonyms
- EWS antibody, bK984G1.4 antibody, AU018891 antibody, Ews antibody, Ewsh antibody, EWSR1 antibody, fc04c01 antibody, wu:fc04c01 antibody, DKFZp459K1116 antibody, ewsr1 antibody, ewsr1.S antibody, fb40b11 antibody, fusl antibody, wu:fb40b11 antibody, wu:fb75g09 antibody, zgc:55864 antibody, EWS RNA binding protein 1 antibody, Ewing sarcoma breakpoint region 1 antibody, EWS RNA-binding protein 1 antibody, EWS RNA-binding protein 1a antibody, EWS RNA binding protein 1 L homeolog antibody, EWS RNA-binding protein 1b antibody, EWSR1 antibody, Ewsr1 antibody, ewsr1a antibody, ewsr1 antibody, ewsr1.L antibody, ewsr1b antibody
- Background
- EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.
- Molecular Weight
- 52 kDa (MW of target protein)
-