EWSR1 antibody (N-Term)

Catalog No. ABIN633586

Product Details anti-EWSR1 Antibody

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EWSR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EWSR1 antibody was raised against the N terminal of EWSR1

Purification: Affinity purified

Immunogen: EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EWSR1 Blocking Peptide, catalog no. 33R-7315, is also available for use as a blocking control in assays to test for specificity of this EWSR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EWSR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EWSR1

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Alternative Name: EWSR1 (EWSR1 Products)

Synonyms: EWS antibody, bK984G1.4 antibody, AU018891 antibody, Ews antibody, Ewsh antibody, EWSR1 antibody, fc04c01 antibody, wu:fc04c01 antibody, DKFZp459K1116 antibody, ewsr1 antibody, ewsr1.S antibody, fb40b11 antibody, fusl antibody, wu:fb40b11 antibody, wu:fb75g09 antibody, zgc:55864 antibody, EWS RNA binding protein 1 antibody, Ewing sarcoma breakpoint region 1 antibody, EWS RNA-binding protein 1 antibody, EWS RNA-binding protein 1a antibody, EWS RNA binding protein 1 L homeolog antibody, EWS RNA-binding protein 1b antibody, EWSR1 antibody, Ewsr1 antibody, ewsr1a antibody, ewsr1 antibody, ewsr1.L antibody, ewsr1b antibody

Background: EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.

Molecular Weight: 52 kDa (MW of target protein)