TIA1 antibody (N-Term)

Catalog No. ABIN633608

Product Details anti-TIA1 Antibody

Target: TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TIA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TIA1 antibody was raised against the N terminal of TIA1

Purification: Affinity purified

Immunogen: TIA1 antibody was raised using the N terminal of TIA1 corresponding to a region with amino acids MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TIA1 Blocking Peptide, catalog no. 33R-6040, is also available for use as a blocking control in assays to test for specificity of this TIA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TIA1

Target: TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))

Alternative Name: TIA1 (TIA1 Products)

Background: TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognises poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15 kDa protein that is thought to be derived from the carboxyl terminus of the 40 kDa product by proteolytic processing.

Molecular Weight: 43 kDa (MW of target protein)