ASIC1 antibody (N-Term)

Catalog No. ABIN633632

The Rabbit Polyclonal anti-ASIC1 antibody has been validated for WB. It is suitable to detect ASIC1 in samples from Human, Mouse and Rat.

Quick Overview for ASIC1 antibody (N-Term) (ABIN633632)

Target: ASIC1 (ACCN2) (Amiloride-Sensitive Cation Channel 2, Neuronal (ACCN2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASIC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ASIC1 Antibody

Binding Specificity: N-Term

Specificity: ACCN2 antibody was raised against the N terminal of ACCN2

Purification: Affinity purified

Immunogen: ACCN2 antibody was raised using the N terminal of ACCN2 corresponding to a region with amino acids MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACCN2 Blocking Peptide, (ABIN5611891), is also available for use as a blocking control in assays to test for specificity of this ACCN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASIC1

Target: ASIC1 (ACCN2) (Amiloride-Sensitive Cation Channel 2, Neuronal (ACCN2))

Alternative Name: ACCN2

Background: ACCN2 is the cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. ACCN2 is also permeable for Ca2+, Li+ and K+. ACCN2 generates a biphasic current with a fast inactivating and a slow sustained phase. ACCN2 mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties.

Molecular Weight: 65 kDa (MW of target protein)