ACCN1 antibody

Catalog No. ABIN633672

Product Details anti-ACCN1 Antibody

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACCN1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACCN1 Blocking Peptide, catalog no. 33R-5124, is also available for use as a blocking control in assays to test for specificity of this ACCN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACCN1

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Alternative Name: ACCN1 (ACCN1 Products)

Synonyms: ACCN antibody, ACCN1 antibody, ASIC2a antibody, BNC1 antibody, BNaC1 antibody, MDEG antibody, hBNaC1 antibody, ACIC2 antibody, Accn1 antibody, BNaC1a antibody, Mdeg antibody, BNC1k antibody, MDEG1 antibody, MDEG2 antibody, accn1 antibody, zASIC2 antibody, acid sensing ion channel subunit 2 antibody, acid-sensing (proton-gated) ion channel 2 antibody, ASIC2 antibody, Asic2 antibody, asic2 antibody

Background: ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Sensory Perception of Sound