KCNJ5 antibody (N-Term)

Catalog No. ABIN633707

Product Details anti-KCNJ5 Antibody

Target: KCNJ5 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNJ5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNJ5 antibody was raised against the N terminal of KCNJ5

Purification: Affinity purified

Immunogen: KCNJ5 antibody was raised using the N terminal of KCNJ5 corresponding to a region with amino acids AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNJ5 Blocking Peptide, catalog no. 33R-1190, is also available for use as a blocking control in assays to test for specificity of this KCNJ5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNJ5

Target: KCNJ5 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5))

Alternative Name: KCNJ5 (KCNJ5 Products)

Background: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ5 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ5, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It may associate with two other G-protein-activated potassium channels to form a heteromultimeric pore-forming complex.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Notch Signaling