TRPM4 antibody (N-Term)

Catalog No. ABIN633730

This Rabbit Polyclonal antibody specifically detects TRPM4 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for TRPM4 antibody (N-Term) (ABIN633730)

Target: TRPM4 (Transient Receptor Potential Cation Channel, Subfamily M, Member 4 (TRPM4))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPM4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRPM4 Antibody

Binding Specificity: N-Term

Specificity: TRPM4 antibody was raised against the N terminal of TRPM4

Purification: Affinity purified

Immunogen: TRPM4 antibody was raised using the N terminal of TRPM4 corresponding to a region with amino acids ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPM4 Blocking Peptide, (ABIN937946), is also available for use as a blocking control in assays to test for specificity of this TRPM4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPM4

Target: TRPM4 (Transient Receptor Potential Cation Channel, Subfamily M, Member 4 (TRPM4))

Alternative Name: TRPM4

Background: TRPM4 is a calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca2+, it is impermeable to it. TRPM4 mediates transport of monovalent cations (Na+ > K+ > Cs+ > Li+), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca2+ oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production.

Molecular Weight: 134 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Production of Molecular Mediator of Immune Response