NR2E1 antibody (Middle Region)

Catalog No. ABIN633801

Product Details anti-NR2E1 Antibody

Target: NR2E1 (Nuclear Receptor Subfamily 2, Group E, Member 1 (NR2E1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR2E1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NR2 E1 antibody was raised against the middle region of NR2 1

Purification: Affinity purified

Immunogen: NR2 E1 antibody was raised using the middle region of NR2 1 corresponding to a region with amino acids LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR2E1 Blocking Peptide, catalog no. 33R-4758, is also available for use as a blocking control in assays to test for specificity of this NR2E1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR2E1

Target: NR2E1 (Nuclear Receptor Subfamily 2, Group E, Member 1 (NR2E1))

Alternative Name: NR2E1 (NR2E1 Products)

Background: The NR2E1 gene is a member of the steroid nuclear receptor superfamily and is predominately expressed in the brain. The contributions of this gene to human B-cell leukemia and to brain development are unknown at present.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Stem Cell Maintenance