Glutathione Reductase antibody (N-Term)

Catalog No. ABIN633841

Product Details anti-Glutathione Reductase Antibody

Target: Glutathione Reductase (GSR)

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glutathione Reductase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GSR antibody was raised against the N terminal of GSR

Purification: Affinity purified

Immunogen: GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSR Blocking Peptide, catalog no. 33R-7387, is also available for use as a blocking control in assays to test for specificity of this GSR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glutathione Reductase

Target: Glutathione Reductase (GSR)

Alternative Name: GSR (GSR Products)

Synonyms: GR antibody, ATGR2 antibody, EMB2360 antibody, glutathione reductase antibody, AI325518 antibody, D8Ertd238e antibody, Gr-1 antibody, Gr1 antibody, DDBDRAFT_0168952 antibody, DDBDRAFT_0231410 antibody, DDB_0168952 antibody, DDB_0231410 antibody, 2151 antibody, CG2151 antibody, DTR antibody, Dm-TrxR antibody, DmTR antibody, DmTrx antibody, DmTrxR antibody, DmTrxR-1 antibody, Dmel\\CG2151 antibody, Gr antibody, Trx antibody, TrxR antibody, TrxR-1 antibody, Trxr1 antibody, anon-WO03040301.185 antibody, anon-WO03040301.187 antibody, dTrxR antibody, dmtrxr-1 antibody, gr antibody, l(1)G0154 antibody, l(1)G0379 antibody, l(1)G0477 antibody, l(1)G0481 antibody, trxr-1 antibody, gor1 antibody, glutathione reductase, gro-2 antibody, glutathione reductase antibody, glutathione-disulfide reductase antibody, GR; GRase antibody, mitochondrial glutathione reductase Pgr1 antibody, Glutathione reductase (GR) (GRase) antibody, Thioredoxin reductase-1 antibody, glutathione-disulfide reductase family protein antibody, glutathione reductase 1 antibody, GR antibody, gor antibody, GSR antibody, GSR1 antibody, Gsr_2 antibody, Gsr antibody, GSHR1 antibody, gsr antibody, LbGR antibody, pgr1 antibody, GSHR2 antibody, GLR2 antibody, Bcen_2392 antibody, RPE_1989 antibody, HCAG_02219 antibody, SJAG_01162 antibody, Trxr-1 antibody, PF14_0192 antibody, POPTR_0001s14480g antibody, gsr1 antibody

Background: GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Cell RedoxHomeostasis