GPX3 antibody
-
- Target See all GPX3 Antibodies
- GPX3 (Glutathione Peroxidase 3 (Plasma) (GPX3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPX3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GPX3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
- Top Product
- Discover our top product GPX3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPX3 Blocking Peptide, catalog no. 33R-1870, is also available for use as a blocking control in assays to test for specificity of this GPX3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPX3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPX3 (Glutathione Peroxidase 3 (Plasma) (GPX3))
- Alternative Name
- GPX3 (GPX3 Products)
- Background
- GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis
-