Sep 15 antibody (Middle Region)

Catalog No. ABIN633919

This Rabbit Polyclonal antibody specifically detects Sep 15 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Sep 15 antibody (Middle Region) (ABIN633919)

Target: Sep 15 (SEP15) (15 KDa Selenoprotein (SEP15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Sep 15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Sep 15 Antibody

Binding Specificity: Middle Region

Specificity: Selenoprotein antibody was raised against the middle region of 15 kDa Selenoprotein

Purification: Affinity purified

Immunogen: Selenoprotein antibody was raised using the middle region of 15 kDa Selenoprotein corresponding to a region with amino acids SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Selenoprotein Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Selenoprotein antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 42248 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Sep 15

Target: Sep 15 (SEP15) (15 KDa Selenoprotein (SEP15))

Alternative Name: Selenoprotein

Background: SEP15 is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. The gene that encodes the protein is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers.

Molecular Weight: 15 kDa (MW of target protein)