Sep 15 antibody (Middle Region)

Catalog No. ABIN633919

Product Details anti-Sep 15 Antibody

Target: Sep 15 (SEP15) (15 KDa Selenoprotein (SEP15))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Sep 15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Selenoprotein antibody was raised against the middle region of 15 kDa Selenoprotein

Purification: Affinity purified

Immunogen: Selenoprotein antibody was raised using the middle region of 15 kDa Selenoprotein corresponding to a region with amino acids SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Selenoprotein Blocking Peptide, catalog no. 33R-8360, is also available for use as a blocking control in assays to test for specificity of this Selenoprotein antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 42248 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Sep 15

Target: Sep 15 (SEP15) (15 KDa Selenoprotein (SEP15))

Alternative Name: Selenoprotein (SEP15 Products)

Synonyms: 9430015P09Rik antibody, cb29 antibody, zgc:86882 antibody, BcDNA:SD16138 antibody, Dmel\\CG7484 antibody, Prise 8 antibody, Sep15 antibody, selenoprotein F antibody, CG7484 gene product from transcript CG7484-RB antibody, SELENOF antibody, Selenof antibody, selenof antibody, CG7484 antibody

Background: SEP15 is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. The gene that encodes the protein is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers.

Molecular Weight: 15 kDa (MW of target protein)