HMGCL antibody

Catalog No. ABIN633970

Product Details anti-HMGCL Antibody

Target: HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HMGCL antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HMGCL Blocking Peptide, catalog no. 33R-4801, is also available for use as a blocking control in assays to test for specificity of this HMGCL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HMGCL

Target: HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))

Alternative Name: HMGCL (HMGCL Products)

Synonyms: Afu7g01720 antibody, AO090038000541 antibody, AW476067 antibody, HL antibody, zgc:56248 antibody, 3-hydroxymethyl-3-methylglutaryl-CoA lyase S homeolog antibody, 3-hydroxymethyl-3-methylglutaryl-CoA lyase antibody, 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase antibody, 3-hydroxy-3-methylglutaryl-Coenzyme A lyase antibody, hmgcl.S antibody, HMGCL antibody, AFUA_7G01720 antibody, NFIA_114450 antibody, ACLA_065820 antibody, AOR_1_910074 antibody, PMAA_004600 antibody, TSTA_103060 antibody, ARB_04874 antibody, TRV_06573 antibody, Hmgcl antibody, hmgcl antibody

Background: The HMGCL protein belongs to the HMG-CoA lyase family. It is a mitochondrial enzyme that catalyzes the final step of leucine degradation and plays a key role in ketone body formation. Mutations in this gene are associated with HMG-CoA lyase deficiency.

Molecular Weight: 36 kDa (MW of target protein)