RDH12 antibody

Catalog No. ABIN634023

The Rabbit Polyclonal anti-RDH12 antibody (ABIN634023) specifically detects RDH12 in WB. The antibody is reactive with Human samples.

Quick Overview for RDH12 antibody (ABIN634023)

Target: RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RDH12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RDH12 Antibody

Purification: Affinity purified

Immunogen: RDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RDH12 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this RDH12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RDH12

Target: RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))

Alternative Name: RDH12

Background: RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3). The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).

Molecular Weight: 35 kDa (MW of target protein)