RBP4 antibody (N-Term)

Catalog No. ABIN634030

This Rabbit Polyclonal antibody specifically detects RBP4 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RBP4 antibody (N-Term) (ABIN634030)

Target: RBP4 (Retinol Binding Protein 4, Plasma (RBP4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBP4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RBP4 Antibody

Binding Specificity: N-Term

Specificity: RBP4 antibody was raised against the N terminal of RBP4

Purification: Affinity purified

Immunogen: RBP4 antibody was raised using the N terminal of RBP4 corresponding to a region with amino acids MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBP4 Blocking Peptide, (ABIN5615808), is also available for use as a blocking control in assays to test for specificity of this RBP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBP4

Target: RBP4 (Retinol Binding Protein 4, Plasma (RBP4))

Alternative Name: RBP4

Background: This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways, Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis, Production of Molecular Mediator of Immune Response