CDC25B antibody

Catalog No. ABIN634076

The Rabbit Polyclonal anti-CDC25B antibody has been validated for WB and IHC. It is suitable to detect CDC25B in samples from Human and Dog.

Quick Overview for CDC25B antibody (ABIN634076)

Target: CDC25B (Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDC25B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CDC25B Antibody

Purification: Affinity purified

Immunogen: CDC25 B antibody was raised using a synthetic peptide corresponding to a region with amino acids TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDC25B Blocking Peptide, (ABIN5612773), is also available for use as a blocking control in assays to test for specificity of this CDC25B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDC25B

Target: CDC25B (Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B))

Alternative Name: CDC25B

Background: CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Cell Division Cycle, M Phase, Autophagy