MAPK4 antibody (Middle Region)

Catalog No. ABIN634082

Product Details anti-MAPK4 Antibody

Target: MAPK4 (Mitogen-Activated Protein Kinase 4 (MAPK4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAPK4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAPK4 antibody was raised against the middle region of MAPK4

Purification: Affinity purified

Immunogen: MAPK4 antibody was raised using the middle region of MAPK4 corresponding to a region with amino acids DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAPK4 Blocking Peptide, catalog no. 33R-1930, is also available for use as a blocking control in assays to test for specificity of this MAPK4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAPK4

Target: MAPK4 (Mitogen-Activated Protein Kinase 4 (MAPK4))

Alternative Name: MAPK4 (MAPK4 Products)

Synonyms: ERK-4 antibody, ERK3 antibody, Erk4 antibody, MAPK 4 antibody, PRKM4 antibody, p63MAPK antibody, A330097D03Rik antibody, Erk3 antibody, Prkm4 antibody, p63Mapk antibody, erk4 antibody, wu:fi27d11 antibody, zgc:55498 antibody, ATMPK4 antibody, F2N1.1 antibody, F2N1_1 antibody, MAP kinase 4 antibody, mitogen-activated protein kinase 4 antibody, MAP kinase 4 antibody, MAPK4 antibody, Mapk4 antibody, mapk4 antibody, MPK4 antibody

Background: Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targets.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: MAPK Signaling