HERC5 antibody (N-Term)

Catalog No. ABIN634097

The Rabbit Polyclonal anti-HERC5 antibody has been validated for WB. It is suitable to detect HERC5 in samples from Human.

Quick Overview for HERC5 antibody (N-Term) (ABIN634097)

Target: HERC5 (Hect Domain and RLD 5 (HERC5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HERC5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HERC5 Antibody

Binding Specificity: N-Term

Specificity: HERC5 antibody was raised against the N terminal of HERC5

Purification: Affinity purified

Immunogen: HERC5 antibody was raised using the N terminal of HERC5 corresponding to a region with amino acids CLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HERC5 Blocking Peptide, (ABIN937135), is also available for use as a blocking control in assays to test for specificity of this HERC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HERC5

Target: HERC5 (Hect Domain and RLD 5 (HERC5))

Alternative Name: HERC5

Background: HERC5 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Molecular Weight: 117 kDa (MW of target protein)