MCM2 antibody (Middle Region)

Catalog No. ABIN634144

This Rabbit Polyclonal antibody specifically detects MCM2 in WB. It exhibits reactivity toward Human.

Quick Overview for MCM2 antibody (Middle Region) (ABIN634144)

Target: MCM2 (Minichromosome Maintenance Complex Component 2 (MCM2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCM2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MCM2 Antibody

Binding Specificity: Middle Region

Specificity: MCM2 antibody was raised against the middle region of MCM2

Purification: Affinity purified

Immunogen: MCM2 antibody was raised using the middle region of MCM2 corresponding to a region with amino acids NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MCM2 Blocking Peptide, (ABIN5614696), is also available for use as a blocking control in assays to test for specificity of this MCM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MCM2

Target: MCM2 (Minichromosome Maintenance Complex Component 2 (MCM2))

Alternative Name: MCM2

Background: This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins.

Molecular Weight: 102 kDa (MW of target protein)

Pathways: DNA Damage Repair, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA