NUP98 antibody (N-Term)
-
- Target See all NUP98 Antibodies
- NUP98 (Nucleoporin 98kDa (NUP98))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUP98 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NUP98 antibody was raised against the N terminal of NUP98
- Purification
- Affinity purified
- Immunogen
- NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF
- Top Product
- Discover our top product NUP98 Primary Antibody
-
anti-Nucleoporin 98kDa (NUP98) (GLFG Motif), (N-Term) antibody
NUP98 Reactivity: Human, Mouse, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Tetrahymena WB, IF Host: Mouse Monoclonal 21A10 unconjugated
anti-Nucleoporin 98kDa (NUP98) (FGxxN Motif), (N-Term) antibodyNUP98 Reactivity: Human, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Tetrahymena WB, IF Host: Mouse Monoclonal 13C2 unconjugated
anti-Nucleoporin 98kDa (NUP98) (AA 1-466) antibodyNUP98 Reactivity: Human, Mouse, Rat, Saccharomyces cerevisiae, Schizosaccharomyces pombe WB, ELISA, IF, ICC, DB Host: Rat Monoclonal 2H10 unconjugated
anti-Nucleoporin 98kDa (NUP98) (AA 965-1110) antibodyNUP98 Reactivity: Human WB, ELISA, IP, IF Host: Rabbit Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) antibodyNUP98 Reactivity: Human WB, ELISA, IF, IHC Host: Rabbit Monoclonal 2H4 unconjugated Recombinant Antibody
anti-Nucleoporin 98kDa (NUP98) (AA 621-920) antibodyNUP98 Reactivity: Human WB, IF Host: Rabbit Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) antibodyNUP98 Reactivity: Human WB, IP Host: Mouse Monoclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) (AA 1-606) antibodyNUP98 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) antibodyNUP98 Reactivity: Human, Mouse, Rat WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) (Internal Region) antibodyNUP98 Reactivity: Human WB, ELISA, IF, ICC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NUP98 Blocking Peptide, catalog no. 33R-2374, is also available for use as a blocking control in assays to test for specificity of this NUP98 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP98 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUP98 (Nucleoporin 98kDa (NUP98))
- Alternative Name
- NUP98 (NUP98 Products)
- Background
- The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kDa nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kDa nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL).
- Molecular Weight
- 98 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance, Protein targeting to Nucleus, SARS-CoV-2 Protein Interactome
-
