NUP98 antibody (N-Term)

Catalog No. ABIN634181

The Rabbit Polyclonal anti-NUP98 antibody has been validated for WB. It is suitable to detect NUP98 in samples from Human and Rat.

Quick Overview for NUP98 antibody (N-Term) (ABIN634181)

Target: NUP98 (Nucleoporin 98kDa (NUP98))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUP98 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NUP98 Antibody

Binding Specificity: N-Term

Specificity: NUP98 antibody was raised against the N terminal of NUP98

Purification: Affinity purified

Immunogen: NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUP98 Blocking Peptide, (ABIN937760), is also available for use as a blocking control in assays to test for specificity of this NUP98 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP98 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUP98

Target: NUP98 (Nucleoporin 98kDa (NUP98))

Alternative Name: NUP98

Background: The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kDa nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kDa nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL).

Molecular Weight: 98 kDa (MW of target protein)

Pathways: Stem Cell Maintenance, Protein targeting to Nucleus, SARS-CoV-2 Protein Interactome