Retinoblastoma Binding Protein 4 antibody (N-Term)

Catalog No. ABIN634184

The Rabbit Polyclonal anti-Retinoblastoma Binding Protein 4 antibody has been validated for WB. It is suitable to detect Retinoblastoma Binding Protein 4 in samples from Human, Mouse and Rat.

Quick Overview for Retinoblastoma Binding Protein 4 antibody (N-Term) (ABIN634184)

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Retinoblastoma Binding Protein 4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Retinoblastoma Binding Protein 4 Antibody

Binding Specificity: N-Term

Specificity: RBBP4 antibody was raised against the N terminal of RBBP4

Purification: Affinity purified

Immunogen: RBBP4 antibody was raised using the N terminal of RBBP4 corresponding to a region with amino acids HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBBP4 Blocking Peptide, (ABIN939251), is also available for use as a blocking control in assays to test for specificity of this RBBP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Retinoblastoma Binding Protein 4

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Alternative Name: RBBP4

Background: This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Cell Division Cycle, Mitotic G1-G1/S Phases, Stem Cell Maintenance, Chromatin Binding, Protein targeting to Nucleus