POLM antibody

Catalog No. ABIN634192

This Rabbit Polyclonal antibody specifically detects POLM in WB. It exhibits reactivity toward Human.

Quick Overview for POLM antibody (ABIN634192)

Target: POLM (Polymerase (DNA Directed), mu (POLM))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLM antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-POLM Antibody

Purification: Affinity purified

Immunogen: POLM antibody was raised using a synthetic peptide corresponding to a region with amino acids LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLM Blocking Peptide, (ABIN5615459), is also available for use as a blocking control in assays to test for specificity of this POLM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLM

Target: POLM (Polymerase (DNA Directed), mu (POLM))

Alternative Name: POLM

Background: POLM seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: DNA Damage Repair, Production of Molecular Mediator of Immune Response