POLL antibody

Catalog No. ABIN634210

This Rabbit Polyclonal antibody specifically detects POLL in WB. It exhibits reactivity toward Human.

Quick Overview for POLL antibody (ABIN634210)

Target: POLL (Polymerase (DNA Directed), lambda (POLL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-POLL Antibody

Purification: Affinity purified

Immunogen: POLL antibody was raised using a synthetic peptide corresponding to a region with amino acids SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLL Blocking Peptide, (ABIN5615458), is also available for use as a blocking control in assays to test for specificity of this POLL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLL

Target: POLL (Polymerase (DNA Directed), lambda (POLL))

Alternative Name: POLL

Background: POLL is a repair polymerase.It is involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: DNA Damage Repair, Production of Molecular Mediator of Immune Response