RNASEH2A antibody (C-Term)

Catalog No. ABIN634223

The Rabbit Polyclonal anti-RNASEH2A antibody has been validated for WB and IHC. It is suitable to detect RNASEH2A in samples from Human.

Quick Overview for RNASEH2A antibody (C-Term) (ABIN634223)

Target: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNASEH2A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RNASEH2A Antibody

Binding Specificity: C-Term

Specificity: RNASEH2 A antibody was raised against the C terminal of RNASEH2

Purification: Affinity purified

Immunogen: RNASEH2 A antibody was raised using the C terminal of RNASEH2 corresponding to a region with amino acids EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNASEH2A Blocking Peptide, (ABIN937886), is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNASEH2A

Target: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Alternative Name: RNASEH2A

Background: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Molecular Weight: 33 kDa (MW of target protein)