FRK antibody (N-Term)

Catalog No. ABIN634237

This Rabbit Polyclonal antibody specifically detects FRK in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for FRK antibody (N-Term) (ABIN634237)

Target: FRK (Fyn-Related Kinase (FRK))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FRK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FRK Antibody

Binding Specificity: N-Term

Specificity: FRK antibody was raised against the N terminal of FRK

Purification: Affinity purified

Immunogen: FRK antibody was raised using the N terminal of FRK corresponding to a region with amino acids LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FRK Blocking Peptide, (ABIN940218), is also available for use as a blocking control in assays to test for specificity of this FRK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FRK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FRK

Target: FRK (Fyn-Related Kinase (FRK))

Alternative Name: FRK

Background: The specific function of FRK is not yet known.

Molecular Weight: 58 kDa (MW of target protein)