Phospholipase C beta 1 antibody

Catalog No. ABIN634242

The Rabbit Polyclonal anti-Phospholipase C beta 1 antibody (ABIN634242) specifically detects Phospholipase C beta 1 in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for Phospholipase C beta 1 antibody (ABIN634242)

Target: Phospholipase C beta 1 (PLCB1) (phospholipase C, beta 1 (phosphoinositide-Specific) (PLCB1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Phospholipase C beta 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Phospholipase C beta 1 Antibody

Purification: Affinity purified

Immunogen: PLCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLCB1 Blocking Peptide, (ABIN937664), is also available for use as a blocking control in assays to test for specificity of this PLCB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Phospholipase C beta 1

Target: Phospholipase C beta 1 (PLCB1) (phospholipase C, beta 1 (phosphoinositide-Specific) (PLCB1))

Alternative Name: PLCB1

Background: The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in intracellular transduction.

Molecular Weight: 134 kDa (MW of target protein)

Pathways: WNT Signaling, AMPK Signaling, Thyroid Hormone Synthesis, Inositol Metabolic Process, Regulation of Muscle Cell Differentiation, Regulation of G-Protein Coupled Receptor Protein Signaling, Proton Transport, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, G-protein mediated Events