MAPK12 antibody (N-Term)

Catalog No. ABIN634255

This Rabbit Polyclonal antibody specifically detects MAPK12 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MAPK12 antibody (N-Term) (ABIN634255)

Target: MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAPK12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAPK12 Antibody

Binding Specificity: N-Term

Specificity: MAPK12 antibody was raised against the N terminal of MAPK12

Purification: Affinity purified

Immunogen: MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAPK12 Blocking Peptide, (ABIN5614663), is also available for use as a blocking control in assays to test for specificity of this MAPK12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAPK12

Target: MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))

Alternative Name: MAPK12

Background: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: MAPK Signaling, Neurotrophin Signaling Pathway, Regulation of Muscle Cell Differentiation, Hepatitis C, BCR Signaling, S100 Proteins