MAPK12 antibody (N-Term)
-
- Target See all MAPK12 Antibodies
- MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAPK12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAPK12 antibody was raised against the N terminal of MAPK12
- Purification
- Affinity purified
- Immunogen
- MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE
- Top Product
- Discover our top product MAPK12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAPK12 Blocking Peptide, catalog no. 33R-8447, is also available for use as a blocking control in assays to test for specificity of this MAPK12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))
- Alternative Name
- MAPK12 (MAPK12 Products)
- Synonyms
- ATMPK12 antibody, MAPK12 antibody, T3F17.28 antibody, mitogen-activated protein kinase 12 antibody, MGC160082 antibody, si:dkey-14d8.5 antibody, erk6 antibody, etID309866.18 antibody, mapk12 antibody, sapk3 antibody, wu:fa05c12 antibody, zgc:101695 antibody, ERK3 antibody, ERK6 antibody, P38GAMMA antibody, PRKM12 antibody, SAPK-3 antibody, SAPK3 antibody, AW123708 antibody, Erk6 antibody, P38gamma antibody, Prkm12 antibody, Sapk3 antibody, mitogen-activated protein kinase 12 antibody, mitogen-activated protein kinase 12b antibody, mitogen-activated protein kinase 12a antibody, MPK12 antibody, MAPK12 antibody, mapk12b antibody, mapk12a antibody, Mapk12 antibody
- Background
- Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- MAPK Signaling, Neurotrophin Signaling Pathway, Regulation of Muscle Cell Differentiation, Hepatitis C, BCR Signaling, S100 Proteins
-