Presenilin 2 antibody

Catalog No. ABIN634258

Product Details anti-Presenilin 2 Antibody

Target: Presenilin 2 (PSEN2) (Presenilin 2 (Alzheimer Disease 4) (PSEN2))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Presenilin 2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: Presenilin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Presenilin 2 Blocking Peptide, catalog no. 33R-9902, is also available for use as a blocking control in assays to test for specificity of this Presenilin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSEN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Presenilin 2

Target: Presenilin 2 (PSEN2) (Presenilin 2 (Alzheimer Disease 4) (PSEN2))

Alternative Name: Presenilin 2 (PSEN2 Products)

Synonyms: AD3L antibody, AD4 antibody, CMD1V antibody, PS2 antibody, STM2 antibody, ALG-3 antibody, Ad4h antibody, Alg3 antibody, PS-2 antibody, Psnl2 antibody, pre2 antibody, zf-PS2 antibody, PSNL2 antibody, PSEN2 antibody, ad4 antibody, ps2 antibody, ad3l antibody, stm2 antibody, Ps2 antibody, presenilin 2 antibody, presenilin 2 S homeolog antibody, presenilin 2 (Alzheimer disease 4) antibody, trefoil factor 1 antibody, PSEN2 antibody, Psen2 antibody, psen2 antibody, psen2.S antibody, Tff1 antibody

Background: Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Notch Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway