GNAQ antibody

Catalog No. ABIN634295

The Rabbit Polyclonal anti-GNAQ antibody is suitable to detect GNAQ in samples from Human, Mouse, Rat and Dog. It has been validated for WB.

Quick Overview for GNAQ antibody (ABIN634295)

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNAQ antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GNAQ Antibody

Purification: Affinity purified

Immunogen: GNAQ antibody was raised using a synthetic peptide corresponding to a region with amino acids DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNAQ Blocking Peptide, (ABIN937416), is also available for use as a blocking control in assays to test for specificity of this GNAQ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNAQ

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Alternative Name: GNAQ

Background: Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction