GNAQ antibody
-
- Target See all GNAQ Antibodies
- GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GNAQ antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GNAQ antibody was raised using a synthetic peptide corresponding to a region with amino acids DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
- Top Product
- Discover our top product GNAQ Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GNAQ Blocking Peptide, catalog no. 33R-2030, is also available for use as a blocking control in assays to test for specificity of this GNAQ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAQ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))
- Alternative Name
- GNAQ (GNAQ Products)
- Synonyms
- si:ch73-270f14.2 antibody, CMC1 antibody, G-ALPHA-q antibody, GAQ antibody, SWS antibody, Galphaq antibody, Gnaq antibody, g-alpha-q antibody, gaq antibody, gnaqb antibody, 1110005L02Rik antibody, 6230401I02Rik antibody, AA408290 antibody, AW060788 antibody, Dsk1 antibody, Dsk10 antibody, Gq antibody, GqI antibody, guanine nucleotide binding protein (G protein), q polypeptide antibody, G protein subunit alpha q antibody, guanine nucleotide binding protein (G protein), q polypeptide S homeolog antibody, guanine nucleotide binding protein, alpha q polypeptide antibody, gnaq antibody, GNAQ antibody, Gnaq antibody, gnaq.S antibody
- Background
- Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction
-